Skip to product information
1 of 1

LL-37 Complex (5mg)

LL-37 Complex (5mg)

As low as $113 each!
Regular price $120.00
Regular price Sale price $120.00
Sale Sold out
Shipping calculated at checkout.
  • FREE SHIPPING
  • 99+% PURITY
  • MADE IN USA
View full details

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.

What is LL-37 Complex (5mg)?

LL-37, a member of the cathelicidin family, stands out as the only known human cathelicidin, which is a diverse protein family renowned for its antimicrobial properties. This peptide, primarily located in macrophages and polymorphonuclear leukocytes, crucial white blood cell types, exhibits multifaceted functions, including antimicrobial, antibacterial, antiviral, and anti-fungal activities. Beyond its role in combating infections, LL-37 has been recognized for its anti-inflammatory properties, contributing to the regulation of immune responses.

Recent research has expanded our understanding of LL-37's impact, revealing its potential against certain cancers. The peptide has demonstrated anticancer effects, suggesting a promising avenue for therapeutic intervention. Additionally, LL-37 has been implicated in promoting blood vessel growth in specific contexts, showcasing its involvement in processes crucial for tissue repair and regeneration. The broad spectrum of LL-37's functions underscores its significance not only in the immune system's defense against pathogens but also in influencing diverse physiological processes, ranging from autoimmune diseases to wound healing.

Chemical Structure of LL-37 Complex (5mg)

The chemical structure of LL-37 is that of a cathelicidin peptide, a type of antimicrobial peptide. The specific amino acid sequence of LL-37 is as follows:

[LL-37, 37 aa]

This sequence represents the primary structure of LL-37, where each letter corresponds to a specific amino acid. LL-37 is a relatively short peptide consisting of 37 amino acids and is known for its diverse functions, including antimicrobial, anti-inflammatory, and potential roles in cancer and wound healing.

What Are the Effects of LL-37 Complex (5mg)?

Antimicrobial Properties

LL-37, as a member of the cathelicidin family, exhibits potent antimicrobial effects. It serves as a natural defense mechanism against various microorganisms, including bacteria, viruses, and fungi. LL-37's ability to disrupt the integrity of microbial cell membranes contributes to its effectiveness in combating a broad spectrum of pathogens.

Antibacterial Actions

LL-37 demonstrates specific antibacterial activity, targeting various bacterial strains. Its capacity to interact with bacterial membranes and disrupt cellular functions makes it a valuable component in the body's defense against bacterial infections.

Antiviral Characteristics

LL-37 also exhibits antiviral properties, playing a role in the body's defense against viral infections. Its mechanisms involve interference with viral entry and replication, contributing to the overall antiviral defense system.

Anti-fungal Effects

In addition to its antimicrobial actions, LL-37 has antifungal properties, making it effective against certain fungal pathogens. It contributes to the prevention and control of fungal infections by disrupting fungal cell membranes and functions.

Anti-inflammatory Functions

LL-37 serves as an anti-inflammatory agent, participating in the regulation of the immune response. By modulating inflammatory processes, LL-37 helps maintain a balanced immune system and contributes to the resolution of inflammation associated with various conditions.

These multifaceted effects highlight LL-37's crucial role in the innate immune system, providing protection against a diverse range of microbial threats and contributing to overall immune homeostasis.

COA

Certificate of Analysis

HPLC

High Performance Liquid Chromatography

High Quality - 99% Purity Guaranteed

Product Quality Guarantee

We are continuously conducting HPLC test on all of our raw powders as well as finished products to ensure the quality of our products. You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:
HPLC TEST FEE
$100
PLUS Total amount of the Order + Shipping Fee

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.