Skip to product information
1 of 1

LL-37 (5mg)

LL-37 (5mg)

As low as $66 each!
Regular price $75.00
Regular price Sale price $75.00
Sale Sold out
Shipping calculated at checkout.
  • FREE SHIPPING
  • 99+% PURITY
  • MADE IN USA
View full details

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.

What is LL-37 (5mg)?

LL-37 is a 37-amino acid peptide derived from cathelicidin, a naturally occurring protein in human immune cells. As part of the body’s innate defense mechanism, LL-37 plays a crucial role in combating bacterial, viral, and fungal pathogens. Research highlights its broad-spectrum antimicrobial activity, ability to modulate immune responses, and its role in promoting wound healing and tissue repair. LL-37's antimicrobial properties extend to reducing biofilm formation, a major factor in chronic infections, making it an intriguing focus for ongoing studies into immune health and infection control.

Moreover, LL-37 has demonstrated the ability to influence cellular processes such as angiogenesis (the formation of new blood vessels), tissue regeneration, and inflammation modulation. These properties position LL-37 as a promising peptide for research into antimicrobial therapies, immune regulation, and regenerative medicine.

Derived from a naturally occurring protein in the immune system, synthetic LL-37 retains the vital functions of its natural counterpart, offering potential applications in infection management, chronic wound healing, and even inflammation-related disorders. Researchers continue to explore its potential in therapeutic applications, making LL-37 an exciting area of peptide science.

Chemical Structure of LL-37 (5mg)

LL-37 is a linear cationic amphipathic peptide composed of 37 amino acids. Its amino acid sequence is as follows:

[LL-37, 37 aa]

This structure allows LL-37 to interact with microbial membranes, disrupting their integrity and neutralizing pathogens. Its unique sequence also underpins its immunomodulatory and regenerative properties.

What Are the Effects of LL-37 (5mg)?

Broad-Spectrum Antimicrobial Activity

LL-37 exhibits potent antimicrobial properties, targeting bacteria, viruses, and fungi. Its mechanism involves binding to microbial membranes, destabilizing their structure, and neutralizing harmful pathogens. This makes LL-37 a subject of interest in research on antimicrobial resistance and chronic infections.

Reduces Biofilm Formation

Biofilms are structured communities of microorganisms that resist standard treatments. LL-37 has been shown to inhibit biofilm formation and disrupt existing biofilms, potentially improving outcomes in infections resistant to conventional antibiotics.

Supports Wound Healing and Tissue Repair

LL-37 promotes the regeneration of damaged tissues by enhancing angiogenesis and modulating inflammation. These effects make it a valuable peptide for research into chronic wound healing and regenerative medicine.

Modulates Immune Response

LL-37 helps regulate the immune system by balancing pro-inflammatory and anti-inflammatory responses. This modulation aids in reducing excessive inflammation while still supporting effective pathogen defense, offering potential insights into treatments for autoimmune and inflammatory disorders.

Anti-Inflammatory Effects

Studies have shown that LL-37 can suppress excessive inflammatory responses by interacting with immune signaling pathways. These properties make it a promising candidate for research into conditions involving chronic inflammation, such as arthritis or inflammatory bowel disease.

Potential Applications in Chronic Conditions

Emerging research suggests LL-37 may have therapeutic potential in addressing chronic infections, skin conditions like psoriasis, and even certain cancers. Its ability to influence both innate and adaptive immunity is driving interest in its broader applications.

COA

Certificate of Analysis

HPLC

High Performance Liquid Chromatography

High Quality - 99% Purity Guaranteed

Product Quality Guarantee

We are continuously conducting HPLC test on all of our raw powders as well as finished products to ensure the quality of our products. You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:
HPLC TEST FEE
$100
PLUS Total amount of the Order + Shipping Fee

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)