Skip to product information
1 of 1

IGF-1 LR3 (1mg)

IGF-1 LR3 (1mg)

As low as $70 each!
Regular price $80.00
Regular price Sale price $80.00
Sale Sold out
Shipping calculated at checkout.
  • FREE SHIPPING
  • 99+% PURITY
  • MADE IN USA
View full details

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.

What is IGF-1 LR3 (1mg)?

What is IGF‑1 LR3?

IGF‑1 LR3 (Insulin‑like Growth Factor‑1 Long Arg3) is a recombinant analogue of human IGF‑1, modified to enhance metabolic stability and receptor potency while reducing binding to IGF‑binding proteins (IGFBPs) [4]. The peptide contains the entire native 70-residue IGF‑1 sequence, with two main alterations: a glutamic acid to arginine substitution at position 3 (Arg3), and a 13-amino-acid N-terminal extension (making it “long-R3”) for sustained activity in research settings

Chemical Structure of IGF‑1 LR3

IGF‑1 LR3 is an 83-amino-acid polypeptide with the full sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Key structural features: Arg instead of Glu at position 3, and a 13-amino-acid extension at the N-terminus [1][5]. Its formula is C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉, and the molecular weight is approximately 9,117 Da

What Are the Effects of IGF‑1 LR3?

  • Enhanced Anabolic and Mitogenic Activity: IGF‑1 LR3 demonstrates approximately 3× greater receptor potency than native IGF‑1 and sustains signaling through PI3K/Akt and MAPK pathways due to lower IGFBP binding and extended half-life (~20–30 hours).
  • Cell Proliferation and Protein Synthesis: Promotes cell division, nitrogen retention, protein synthesis, and lean tissue mass accumulation in animal models.
  • Tissue Regenerative Research: Used in muscle, cartilage, nerve, liver, and skin regeneration models, where it enhances nutrient uptake and supports anabolic repair processes.
  • Metabolic Modulation: Facilitates glucose and amino acid uptake while improving insulin sensitivity under metabolic stress conditions.
  • Atherosclerotic Plaque Stability: Helps stabilize atherosclerotic plaques by improving vascular smooth muscle phenotype and reducing plaque vulnerability.

Citations

  1. PubChem Compound Summary – IGF‑1 LR3: molecular structure, Arg3 substitution, and formula Overview of IGF‑1 LR3
  2. Tomas FM, et al. “IGF‑I analogues show greater potency and prolonged effects.” J Endocrinol Overview of IGF‑1 LR3
  3. von der Thüsen JH, et al. “IGF‑1 enhances plaque stability in atherosclerosis.” Am J Pathol Overview of IGF‑1 LR3
  4. Mohan S, Baylink DJ. “IGF‑binding proteins and regulation of IGF activity.” J Endocrinol Overview of IGF‑1 LR3
  5. Tomas FM, Knowles SE, et al. “Anabolic effects of IGF‑I variants in rat models.” Biochem J Overview of IGF‑1 LR3

COA

Certificate of Analysis

HPLC

High Performance Liquid Chromatography

High Quality - 99% Purity Guaranteed

Product Quality Guarantee

We are continuously conducting HPLC test on all of our raw powders as well as finished products to ensure the quality of our products. You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:
HPLC TEST FEE
$100
PLUS Total amount of the Order + Shipping Fee

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.