Skip to product information
1 of 1

IGF-1 LR3 (1mg)

IGF-1 LR3 (1mg)

As low as $70 each!
Regular price $80.00
Regular price Sale price $80.00
Sale Sold out
Shipping calculated at checkout.
  • FREE SHIPPING
  • 99%+ PURITY
  • MADE IN USA
View full details

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.

What is IGF-1 LR3 (1mg)?

IGF‑1 LR3 (Insulin‑like Growth Factor‑1 Long Arg3) is a recombinant analogue of human IGF‑1, modified to enhance metabolic stability and receptor potency while reducing binding to IGF‑binding proteins (IGFBPs) [4]. The peptide contains the entire native 70-residue IGF‑1 sequence, with two main alterations: a glutamic acid to arginine substitution at position 3 (Arg3), and a 13-amino-acid N-terminal extension (making it “long-R3”) for sustained activity in research settings [1].

Chemical Structure of IGF-1 LR3 (1mg)

IGF‑1 LR3 is an 83-amino-acid polypeptide with the full sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA  

Key structural features: Arg instead of Glu at position 3, and a 13-amino-acid extension at the N-terminus [1][5]. Its formula is C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉, and the molecular weight is approximately 9,117 Da [1]. 

What Are the Effects of IGF-1 LR3 (1mg)?

Enhanced Anabolic and Mitogenic Activity:

Exhibits ~3× greater IGF‑1 receptor potency than native IGF‑1 and facilitates prolonged downstream signaling via PI3K/Akt and MAPK pathways due to decreased IGFBP binding and extended half-life (~20–30 h) [2][4]. 

Cell Proliferation and Protein Synthesis:

Demonstrated to increase cell division, nitrogen retention, weight gain, and protein synthesis in animal studies—surpassing effects seen with native IGF‑1 [2]. 

Tissue Regenerative Research:

Applied in studies on muscle, cartilage, nerve, liver, and skin regeneration, where it enhances nutrient uptake, reduces catabolism, and supports repair processes [2]. 

Metabolic Modulation:

Promotes glucose and amino acid transport into cells, indirectly supporting lipid metabolism, and improving insulin sensitivity in models of metabolic stress [5]. 

Atherosclerotic Plaque Stability:

IGF‑1 LR3 improves vascular smooth muscle cell phenotype, increasing cellular components and reducing plaque vulnerability in preclinical atherosclerosis models [3]. 

Citations

  1. PubChem Compound Summary for IGF‑1 LR3 (CID 381123731): includes Arg3 substitution, 13-residue N-terminal extension, formula C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉, MW ~9,117 Da. 
  2. Tomas FM, Lemmey AB, et al. “Superior potency of infused IGF‑I analogues which bind poorly to IGF‑binding proteins is maintained when administered by injection.” J Endocrinol. 1996;150(1):77–84. PMID: 8708565. 
  3. von der Thüsen JH, Borensztajn KS, et al. “IGF‑1 has plaque‑stabilizing effects in atherosclerosis…” Am J Pathol. 2011;178(2):924–934. PMID: 21281823. 
  4. Mohan S, Baylink DJ. “IGF‑binding proteins are multifunctional…” J Endocrinol. 2002;175(1):19–31. PMID: 12379487. 
  5. Tomas FM, Knowles SE, et al. “Insulin‑like growth factor‑I and especially IGF‑I variants are anabolic in dexamethasone‑treated rats.” Biochem J. 1992;282(Pt 1):91–97. PMID: 1371669. 

COA

Certificate of Analysis

HPLC

High Performance Liquid Chromatography

High Quality - 99% Purity Guaranteed

Product Quality Guarantee

We are continuously conducting HPLC test on all of our raw powders as well as finished products to ensure the quality of our products. You can have the product you bought from us tested at any HPLC licensed testing facility and if the results are negative, we will refund the following:
HPLC TEST FEE
$100
PLUS Total amount of the Order + Shipping Fee

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.