LL-37 (5mg)

Product Specifications
CAS Number154947-66-7
Molecular FormulaC205H340N60O53
Molecular Weight (g/mol)4493.27
Amino Acid Count37
Amino Acid SequenceH-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH ([LL-37, 37 aa])
Purity≥99% by HPLC | COA available
Physical FormLyophilized powder
SolubilitySoluble in bacteriostatic water; consult COA for specific solvent recommendations
Storage ConditionsStore at -20°C; protect from light and moisture; reconstitute with bacteriostatic water

For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures.

This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. This product is not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.

Customer Reviews

0.0 0 reviews
5★ 0
4★ 0
3★ 0
2★ 0
1★ 0

There are no reviews yet.

Write a review