LL-37 (5mg)
| Product Specifications | |
|---|---|
| CAS Number | 154947-66-7 |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight (g/mol) | 4493.27 |
| Amino Acid Count | 37 |
| Amino Acid Sequence | H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH ([LL-37, 37 aa]) |
| Purity | ≥99% by HPLC | COA available |
| Physical Form | Lyophilized powder |
| Solubility | Soluble in bacteriostatic water; consult COA for specific solvent recommendations |
| Storage Conditions | Store at -20°C; protect from light and moisture; reconstitute with bacteriostatic water |
For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures.
This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. This product is not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.
Customer Reviews
I've been researching LL-37 for 3 months now due to past lab results coming back showing contaminants! Now more recent lab results show contaminants are gone. The only thing i changed was incorporating LL-37 to my lab routine!!! I will now cycle the lab off for 30 days and start again at the lab for 2 months after that! GREAT pep!
Write a review
You must be logged in to post a comment.