Single Compound Peptides
LL-37 (5mg)
$75.00 SKU PP-LL37-NC-5
| Quantity | Price each |
|---|---|
| 1–4 | $75.00 |
| 5–9 | $72.00 Save 4% |
| 10+ | $66.00 Save 12% |
- Made in the USA
- ≥99% purity, third-party tested
- Shipping included on orders totaling $500 or more
Quality Documents
Latest certificate of analysis
- Analyzed
- Batch/Lot
- L375N070725
- Laboratory
- Janoshik
View COA History (1)
For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures.
This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. This product is not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.
Product specifications
LL-37 (5mg)
Supplied as a lyophilized blend for laboratory research
| Product Specifications | |
|---|---|
| CAS Number | 154947-66-7 |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight (g/mol) | 4493.27 |
| Amino Acid Count | 37 |
| Amino Acid Sequence | H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH ([LL-37, 37 aa]) |
| Purity | ≥99% by HPLC | COA available |
| Physical Form | Lyophilized powder |
| Solubility | Soluble in bacteriostatic water; consult COA for specific solvent recommendations |
| Storage Conditions | Store at -20°C; protect from light and moisture; reconstitute with bacteriostatic water |
Customer reviews
There are no reviews yet.
Used this product? Sign in to share your review.
Sign in to write a review
