LL-37 (10mg)
| Product Specifications | |
|---|---|
| CAS Number | 154947-66-7 |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight (g/mol) | 4493.27 |
| Amino Acid Count | 37 |
| Amino Acid Sequence | H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH ([LL-37, 37 aa]) |
| Purity | ≥99% by HPLC | COA available |
| Physical Form | Lyophilized powder |
| Solubility | Soluble in bacteriostatic water; consult COA for specific solvent recommendations |
| Storage Conditions | Store at -20°C; protect from light and moisture; reconstitute with bacteriostatic water |
For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures.
This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. This product is not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.
Customer Reviews
There are no reviews yet.





