(1 customer review)

P21 / BDNF (Brain-derived neurotrophic factor) (10mg)

$150.00

Quality Documents

Analyzed: September 10, 2024
Batch/Lot: P2124-05-001
COA Document

P21 / BDNF (Brain-derived neurotrophic factor) (10mg) Product Specifications CAS Number Not assigned (recombinant protein) Molecular Formula Recombinant protein; mature BDNF is 119 aa, ~13.5 kDa monomer (functions as homodimer ~27 kDa) Molecular Weight (g/mol) ~13,500 g/mol (monomer); ~27,000 g/mol (homodimer) Amino Acid Count 119 (mature) Amino Acid Sequence Mature human BDNF: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR (UniProt P23560) Purity ≥99% by HPLC | COA available Physical Form Lyophilized powder Solubility Soluble in bacteriostatic water; consult COA for specific solvent recommendations Storage Conditions Store at -20°C; protect from light and moisture; reconstitute with bacteriostatic water For Research Use Only. Not for use in diagnostic,…

893 in stock

FREE SHIPPING
ON ORDERS TOTALLING
$300 OR MORE

99+% PURITY

MADE IN USA

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.

Product Specifications
CAS NumberNot assigned (recombinant protein)
Molecular FormulaRecombinant protein; mature BDNF is 119 aa, ~13.5 kDa monomer (functions as homodimer ~27 kDa)
Molecular Weight (g/mol)~13,500 g/mol (monomer); ~27,000 g/mol (homodimer)
Amino Acid Count119 (mature)
Amino Acid SequenceMature human BDNF: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR (UniProt P23560)
Purity≥99% by HPLC | COA available
Physical FormLyophilized powder
SolubilitySoluble in bacteriostatic water; consult COA for specific solvent recommendations
Storage ConditionsStore at -20°C; protect from light and moisture; reconstitute with bacteriostatic water

For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures.

This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. This product is not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.

Weight0.06 lbs
Title

Default Title

Product Quality Guarantee

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat or cure any medical condition, ailment or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.

Login with OTP