P21 / BDNF (Brain-derived neurotrophic factor) (10mg)
| Product Specifications | |
|---|---|
| CAS Number | Not assigned (recombinant protein) |
| Molecular Formula | Recombinant protein; mature BDNF is 119 aa, ~13.5 kDa monomer (functions as homodimer ~27 kDa) |
| Molecular Weight (g/mol) | ~13,500 g/mol (monomer); ~27,000 g/mol (homodimer) |
| Amino Acid Count | 119 (mature) |
| Amino Acid Sequence | Mature human BDNF: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR (UniProt P23560) |
| Purity | ≥99% by HPLC | COA available |
| Physical Form | Lyophilized powder |
| Solubility | Soluble in bacteriostatic water; consult COA for specific solvent recommendations |
| Storage Conditions | Store at -20°C; protect from light and moisture; reconstitute with bacteriostatic water |
For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures.
This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. This product is not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.
Customer Reviews
The BDNF is extremely high quality. You can feel the antidepressant and mental sharpness right away. Tosses the blood brain barrier no problem. Price is decent for such an expensive compound. Shipping was fast and well protected and packaged. Solid company.
Related Products
University Camo Tees
$45.00Select options This product has multiple variants. The options may be chosen on the product page