P21 / BDNF (Brain-derived neurotrophic factor) (10mg)

Product Specifications
CAS NumberNot assigned (recombinant protein)
Molecular FormulaRecombinant protein; mature BDNF is 119 aa, ~13.5 kDa monomer (functions as homodimer ~27 kDa)
Molecular Weight (g/mol)~13,500 g/mol (monomer); ~27,000 g/mol (homodimer)
Amino Acid Count119 (mature)
Amino Acid SequenceMature human BDNF: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR (UniProt P23560)
Purity≥99% by HPLC | COA available
Physical FormLyophilized powder
SolubilitySoluble in bacteriostatic water; consult COA for specific solvent recommendations
Storage ConditionsStore at -20°C; protect from light and moisture; reconstitute with bacteriostatic water

For Research Use Only. Not for use in diagnostic, therapeutic, or human or animal in-vivo procedures.

This product is sold exclusively for in-vitro laboratory research use. It is not a drug, dietary supplement, food, or cosmetic and has not been approved by the U.S. Food and Drug Administration for any use. This product is not intended to diagnose, treat, cure, mitigate, or prevent any disease. Not for human or animal consumption.

Customer Reviews

5.0 1 review
5★ 1
4★ 0
3★ 0
2★ 0
1★ 0
Enrique Escribano
November 25, 2025

The BDNF is extremely high quality. You can feel the antidepressant and mental sharpness right away. Tosses the blood brain barrier no problem. Price is decent for such an expensive compound. Shipping was fast and well protected and packaged. Solid company.